SCOPe 2.03: Domain d1k25d2: 1k25 D:3693-3749

Lineage for d1k25d2 (1k25 D:3693-3749)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)

8. Domain d1k25d2: 1k25 D:3693-3749 [68046]
   Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4

Details for d1k25d2

PDB Entry: 1k25, 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate

PDB Compounds: (D:) low-affinity PENICILLIN-BINDING PROTEIN 2X

SCOPe Domain Sequences for d1k25d2:

Sequence; same for both SEQRES and ATOM records:

>d1k25d2 d.11.1.1 (D:3693-3749) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
veeipdmygwkketaetfakwldielefegsgsvvqkqdvrtntaiknikkikltlg

Timeline for d1k25d2:

• d1k25d2 first appeared in SCOP 1.59
  
• d1k25d2 appears in SCOPe 2.02
  
• d1k25d2 appears in SCOPe 2.04
  
• d1k25d2 appears in the current release, SCOPe 2.08