Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) |
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
Species Streptococcus pneumoniae [TaxId:1313] [54187] (4 PDB entries) |
Domain d1k25b2: 1k25 B:1693-1749 [68038] Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4 |
PDB Entry: 1k25 (more details), 3.2 Å
SCOP Domain Sequences for d1k25b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k25b2 d.11.1.1 (B:1693-1749) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae} veeipdmygwkketaetfakwldielefegsgsvvqkqdvrtntaiknikkikltlg
Timeline for d1k25b2: