Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries) |
Domain d1k0db2: 1k0d B:100-200 [67933] Other proteins in same PDB: d1k0da1, d1k0db1, d1k0dc1, d1k0dd1 |
PDB Entry: 1k0d (more details), 2.2 Å
SCOP Domain Sequences for d1k0db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0db2 c.47.1.5 (B:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)} sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl
Timeline for d1k0db2: