Lineage for d1jzyk_ (1jzy K:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (10 PDB entries)
  8. 273101Domain d1jzyk_: 1jzy K: [67889]

Details for d1jzyk_

PDB Entry: 1jzy (more details), 3.5 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria

SCOP Domain Sequences for d1jzyk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzyk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOP Domain Coordinates for d1jzyk_:

Click to download the PDB-style file with coordinates for d1jzyk_.
(The format of our PDB-style files is described here.)

Timeline for d1jzyk_: