Class b: All beta proteins [48724] (141 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries) |
Domain d1jzib_: 1jzi B: [67858] complexed with cu, ime, rep |
PDB Entry: 1jzi (more details), 1.62 Å
SCOP Domain Sequences for d1jzib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzib_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal mkgtltlk
Timeline for d1jzib_: