Lineage for d1jzga_ (1jzg A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369114Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 369144Protein Azurin [49530] (6 species)
  7. 369174Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries)
  8. 369175Domain d1jzga_: 1jzg A: [67855]
    complexed with cu1, imf, rtb

Details for d1jzga_

PDB Entry: 1jzg (more details), 1.4 Å

PDB Description: Pseudomonas aeruginosa Reduced Azurin (Cu1+) Ru(tpy)(phen)(His83)

SCOP Domain Sequences for d1jzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1jzga_:

Click to download the PDB-style file with coordinates for d1jzga_.
(The format of our PDB-style files is described here.)

Timeline for d1jzga_: