Lineage for d1jz7c5 (1jz7 C:334-625)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571494Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 571495Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
  8. 571502Domain d1jz7c5: 1jz7 C:334-625 [67824]
    Other proteins in same PDB: d1jz7a1, d1jz7a2, d1jz7a3, d1jz7a4, d1jz7b1, d1jz7b2, d1jz7b3, d1jz7b4, d1jz7c1, d1jz7c2, d1jz7c3, d1jz7c4, d1jz7d1, d1jz7d2, d1jz7d3, d1jz7d4

Details for d1jz7c5

PDB Entry: 1jz7 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galactose

SCOP Domain Sequences for d1jz7c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz7c5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz7c5:

Click to download the PDB-style file with coordinates for d1jz7c5.
(The format of our PDB-style files is described here.)

Timeline for d1jz7c5: