Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (25 PDB entries) Uniprot P00722 |
Domain d1jz7c2: 1jz7 C:626-730 [67821] Other proteins in same PDB: d1jz7a3, d1jz7a4, d1jz7a5, d1jz7b3, d1jz7b4, d1jz7b5, d1jz7c3, d1jz7c4, d1jz7c5, d1jz7d3, d1jz7d4, d1jz7d5 |
PDB Entry: 1jz7 (more details), 1.5 Å
SCOP Domain Sequences for d1jz7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz7c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jz7c2:
View in 3D Domains from same chain: (mouse over for more information) d1jz7c1, d1jz7c3, d1jz7c4, d1jz7c5 |