Lineage for d1jz6d1 (1jz6 D:220-333)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297861Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1297862Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1297863Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1297877Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 1297980Domain d1jz6d1: 1jz6 D:220-333 [67805]
    Other proteins in same PDB: d1jz6a3, d1jz6a4, d1jz6a5, d1jz6b3, d1jz6b4, d1jz6b5, d1jz6c3, d1jz6c4, d1jz6c5, d1jz6d3, d1jz6d4, d1jz6d5
    complexed with dms, gtz, mg, na

Details for d1jz6d1

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6d1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jz6d1:

Click to download the PDB-style file with coordinates for d1jz6d1.
(The format of our PDB-style files is described here.)

Timeline for d1jz6d1: