SCOP 1.73: Domain d1jz3b2: 1jz3 B:626-730

Lineage for d1jz3b2 (1jz3 B:626-730)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)

8. Domain d1jz3b2: 1jz3 B:626-730 [67736]
   Other proteins in same PDB: d1jz3a3, d1jz3a4, d1jz3a5, d1jz3b3, d1jz3b4, d1jz3b5, d1jz3c3, d1jz3c4, d1jz3c5, d1jz3d3, d1jz3d4, d1jz3d5

Details for d1jz3b2

PDB Entry: 1jz3, 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate

PDB Compounds: (B:) beta-galactosidase

SCOP Domain Sequences for d1jz3b2:

Sequence; same for both SEQRES and ATOM records:

>d1jz3b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1jz3b2:

• d1jz3b2 first appeared in SCOP 1.59
  
• d1jz3b2 appears in SCOP 1.71
  
• d1jz3b2 appears in SCOP 1.75
  
• d1jz3b2 appears in the current release, SCOPe 2.08