Lineage for d1jz2d2 (1jz2 D:626-730)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551088Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 551089Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 551090Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 551091Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
  8. 551195Domain d1jz2d2: 1jz2 D:626-730 [67726]
    Other proteins in same PDB: d1jz2a3, d1jz2a4, d1jz2a5, d1jz2b3, d1jz2b4, d1jz2b5, d1jz2c3, d1jz2c4, d1jz2c5, d1jz2d3, d1jz2d4, d1jz2d5
    complexed with 148, 2fg, dms, mg, na

Details for d1jz2d2

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)

SCOP Domain Sequences for d1jz2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2d2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jz2d2:

Click to download the PDB-style file with coordinates for d1jz2d2.
(The format of our PDB-style files is described here.)

Timeline for d1jz2d2: