Class b: All beta proteins [48724] (149 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) |
Protein beta-Galactosidase, domain 5 [49996] (1 species) |
Species Escherichia coli [TaxId:562] [49997] (25 PDB entries) |
Domain d1jz1p4: 1jz1 P:731-1023 [67708] Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5 complexed with 2fg, mg, na |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOP Domain Sequences for d1jz1p4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1p4 b.30.5.1 (P:731-1023) beta-Galactosidase, domain 5 {Escherichia coli} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jz1p4:
View in 3D Domains from same chain: (mouse over for more information) d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5 |
View in 3D Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5 |