Lineage for d1jz1m1 (1jz1 M:220-333)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787894Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 787895Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 787896Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 787910Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 788135Domain d1jz1m1: 1jz1 M:220-333 [67690]
    Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5

Details for d1jz1m1

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400
PDB Compounds: (M:) beta-galactosidase

SCOP Domain Sequences for d1jz1m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1m1 b.1.4.1 (M:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz1m1:

Click to download the PDB-style file with coordinates for d1jz1m1.
(The format of our PDB-style files is described here.)

Timeline for d1jz1m1: