Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
Domain d1jz1k2: 1jz1 K:626-730 [67681] Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5 |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOP Domain Sequences for d1jz1k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1k2 b.1.4.1 (K:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jz1k2:
View in 3D Domains from same chain: (mouse over for more information) d1jz1k1, d1jz1k3, d1jz1k4, d1jz1k5 |
View in 3D Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |