SCOP 1.71: Domain d1jyvb1: 1jyv B:220-333

Lineage for d1jyvb1 (1jyv B:220-333)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)

8. Domain d1jyvb1: 1jyv B:220-333 [67495]
   Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5

Details for d1jyvb1

PDB Entry: 1jyv, 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyvb1:

Sequence; same for both SEQRES and ATOM records:

>d1jyvb1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1jyvb1:

• d1jyvb1 first appeared in SCOP 1.59
  
• d1jyvb1 appears in SCOP 1.69
  
• d1jyvb1 appears in SCOP 1.73
  
• d1jyvb1 appears in the current release, SCOPe 2.08