SCOP 1.75: Domain d1jyob_: 1jyo B:

Lineage for d1jyob_ (1jyo B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (2 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins)
   the family sequences are very divergent

6. Protein Virulence effector SptP secretion chaperone SicP [69639] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [69640] (1 PDB entry)

8. Domain d1jyob_: 1jyo B: [67484]
   Other proteins in same PDB: d1jyoe_, d1jyof_

Details for d1jyob_

PDB Entry: 1jyo, 1.9 Å

PDB Description: Structure of the Salmonella Virulence Effector SptP in Complex with its Secretion Chaperone SicP

PDB Compounds: (B:) SicP

SCOP Domain Sequences for d1jyob_:

Sequence; same for both SEQRES and ATOM records:

>d1jyob_ d.198.1.1 (B:) Virulence effector SptP secretion chaperone SicP {Salmonella typhimurium [TaxId: 90371]}
lqahqdiianigeklglpltfddnnqclllldsdiftsieakddiwllngmiiplspvcg
dsiwrqimvingelaannegtlayidaaetlllihaitdltntyhiisqlesfvnqqeal
knilqeyakv

Timeline for d1jyob_:

• d1jyob_ first appeared in SCOP 1.59
  
• d1jyob_ appears in SCOP 1.73
  
• d1jyob_ appears in SCOPe 2.01
  
• d1jyob_ appears in the current release, SCOPe 2.08