![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) |
![]() | Protein Autoinducer-2 production protein LuxS [64295] (4 species) S-ribosylhomocysteinase |
![]() | Species Bacillus subtilis [TaxId:1423] [64296] (4 PDB entries) |
![]() | Domain d1jvia_: 1jvi A: [67348] complexed with hcs, rhc, so4, zn; mutant |
PDB Entry: 1jvi (more details), 2.2 Å
SCOP Domain Sequences for d1jvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvia_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis} vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft irshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaane kqcgqaklhdlegakrlmrfwlsqdkeellkvfg
Timeline for d1jvia_: