Lineage for d1jskc_ (1jsk C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501582Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 501583Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)
  8. 501589Domain d1jskc_: 1jsk C: [67232]
    Other proteins in same PDB: d1jska_, d1jskb_

Details for d1jskc_

PDB Entry: 1jsk (more details), 3.5 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d

SCOP Domain Sequences for d1jskc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jskc_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus)}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

SCOP Domain Coordinates for d1jskc_:

Click to download the PDB-style file with coordinates for d1jskc_.
(The format of our PDB-style files is described here.)

Timeline for d1jskc_: