| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein NK cell ligand RAE-1 beta [69683] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69684] (3 PDB entries) |
| Domain d1jskc_: 1jsk C: [67232] Other proteins in same PDB: d1jska_, d1jskb_ |
PDB Entry: 1jsk (more details), 3.5 Å
SCOPe Domain Sequences for d1jskc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jskc_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
Timeline for d1jskc_: