Lineage for d1jrpg3 (1jrp G:346-462)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607191Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 607324Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 607325Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 607353Protein Xanthine dehydrogenase chain A, domain 4 [69772] (1 species)
  7. 607354Species Rhodobacter capsulatus [TaxId:1061] [69773] (2 PDB entries)
  8. 607362Domain d1jrpg3: 1jrp G:346-462 [67181]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg4, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mpn

Details for d1jrpg3

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpg3 d.87.2.1 (G:346-462) Xanthine dehydrogenase chain A, domain 4 {Rhodobacter capsulatus}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOP Domain Coordinates for d1jrpg3:

Click to download the PDB-style file with coordinates for d1jrpg3.
(The format of our PDB-style files is described here.)

Timeline for d1jrpg3: