Lineage for d1jrpe4 (1jrp E:179-345)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419683Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 419684Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 419735Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 419753Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 419754Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 419761Domain d1jrpe4: 1jrp E:179-345 [67176]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrph1, d1jrph2

Details for d1jrpe4

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpe4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpe4 d.145.1.3 (E:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOP Domain Coordinates for d1jrpe4:

Click to download the PDB-style file with coordinates for d1jrpe4.
(The format of our PDB-style files is described here.)

Timeline for d1jrpe4: