Class b: All beta proteins [48724] (111 folds) |
Fold b.38: Sm-like fold [50181] (2 superfamilies) |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
Protein Archaeal homoheptameric Sm protein [63758] (4 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries) |
Domain d1jrif_: 1jri F: [67126] |
PDB Entry: 1jri (more details), 2.8 Å
SCOP Domain Sequences for d1jrif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrif_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum} vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl irgdnivyisrgk
Timeline for d1jrif_: