SCOP 1.71: Domain d1jpmb2: 1jpm B:1-125

Lineage for d1jpmb2 (1jpm B:1-125)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundle
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)
Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
C-terminal domain is beta/alpha-barrel
Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
Domain d1jpmb2: 1jpm B:1-125 [67034]
Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1

Details for d1jpmb2

PDB Entry: 1jpm (more details), 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpmb2 d.54.1.1 (B:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg

SCOP Domain Coordinates for d1jpmb2:

Click to download the PDB-style file with coordinates for d1jpmb2.
(The format of our PDB-style files is described here.)

Timeline for d1jpmb2: