Lineage for d1jnrd_ (1jnr D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603244Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 603341Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 603342Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 603343Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (2 PDB entries)
  8. 603345Domain d1jnrd_: 1jnr D: [66973]
    Other proteins in same PDB: d1jnra1, d1jnra2, d1jnra3, d1jnrc1, d1jnrc2, d1jnrc3
    complexed with fad, fs4, gol

Details for d1jnrd_

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnrd_ d.58.1.5 (D:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOP Domain Coordinates for d1jnrd_:

Click to download the PDB-style file with coordinates for d1jnrd_.
(The format of our PDB-style files is described here.)

Timeline for d1jnrd_: