Lineage for d1jkja2 (1jkj A:122-287)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464502Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2464503Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2464510Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2464513Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 2464518Domain d1jkja2: 1jkj A:122-287 [66801]
    Other proteins in same PDB: d1jkja1, d1jkjb1, d1jkjb2, d1jkjd1, d1jkje1, d1jkje2
    complexed with coa, gol, po4, so4

Details for d1jkja2

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS
PDB Compounds: (A:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkja2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOPe Domain Coordinates for d1jkja2:

Click to download the PDB-style file with coordinates for d1jkja2.
(The format of our PDB-style files is described here.)

Timeline for d1jkja2: