Lineage for d1jc9a_ (1jc9 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337110Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 337111Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 337112Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 337191Protein Tachylectin 5a [69861] (1 species)
  7. 337192Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [69862] (1 PDB entry)
  8. 337193Domain d1jc9a_: 1jc9 A: [66490]
    complexed with ca, nag

Details for d1jc9a_

PDB Entry: 1jc9 (more details), 2.01 Å

PDB Description: tachylectin 5a from tachypleus tridentatus (japanese horseshoe crab)

SCOP Domain Sequences for d1jc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc9a_ d.171.1.1 (A:) Tachylectin 5a {Japanese horseshoe crab (Tachypleus tridentatus)}
dptdcadillngyrssggyriwpkswmtvgtlnvycdmetdgggwtviqrrgnygnpsdy
fykpwknyklgfgniekdfwlgndrifaltnqrnymirfdlkdkendtryaiyqdfwien
edylyclhignysgdagnsfgrhnghnfstidkdhdthethcaqtykggwwydrchesnl
nglylngehnsyadgiewrawkgyhyslpqvemkirpvef

SCOP Domain Coordinates for d1jc9a_:

Click to download the PDB-style file with coordinates for d1jc9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc9a_: