Lineage for d1it3b_ (1it3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299592Protein Hagfish hemoglobin [68941] (1 species)
  7. 2299593Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries)
  8. 2299597Domain d1it3b_: 1it3 B: [66368]
    complexed with cmo, hem

Details for d1it3b_

PDB Entry: 1it3 (more details), 2.1 Å

PDB Description: Hagfish CO ligand hemoglobin
PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d1it3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it3b_ a.1.1.2 (B:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay

SCOPe Domain Coordinates for d1it3b_:

Click to download the PDB-style file with coordinates for d1it3b_.
(The format of our PDB-style files is described here.)

Timeline for d1it3b_: