Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hagfish hemoglobin [68941] (1 species) |
Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries) |
Domain d1it3b_: 1it3 B: [66368] complexed with cmo, hem |
PDB Entry: 1it3 (more details), 2.1 Å
SCOPe Domain Sequences for d1it3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it3b_ a.1.1.2 (B:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]} piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi fvstidggaefeklfsiicillrsay
Timeline for d1it3b_: