Lineage for d1it2a_ (1it2 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (18 proteins) 
Protein Hagfish hemoglobin [68941] (1 species) Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries) 
Domain d1it2a_: 1it2 A: [66365]
Details for d1it2a_
PDB Entry: 1it2 (more details), 1.6 Å
PDB Description: Hagfish deoxy hemoglobin
SCOP Domain Sequences for d1it2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri)}
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay
SCOP Domain Coordinates for d1it2a_:
Click to download the PDB-style file with coordinates for d1it2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1it2a_:
- d1it2a_ is new in SCOP 1.59
- d1it2a_ appears in SCOP 1.61
- d1it2a_ appears in the current release, SCOPe 2.08
View in 3D
