![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
![]() | Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries) |
![]() | Domain d1isxb1: 1isx B:804-936 [66351] Other proteins in same PDB: d1isxa2, d1isxb2 complexed with xyp |
PDB Entry: 1isx (more details), 2.1 Å
SCOPe Domain Sequences for d1isxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isxb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]} sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly scsngsnqrwtrt
Timeline for d1isxb1: