Lineage for d1imhd1 (1imh D:368-468)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375024Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2375124Protein T-cell transcription factor NFAT5 (TONEBP) [69170] (1 species)
  7. 2375125Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry)
  8. 2375127Domain d1imhd1: 1imh D:368-468 [66216]
    Other proteins in same PDB: d1imhc2, d1imhd2
    protein/DNA complex

Details for d1imhd1

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex
PDB Compounds: (D:) nuclear factor of activated t cells 5

SCOPe Domain Sequences for d1imhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhd1 b.1.18.1 (D:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]}
vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd

SCOPe Domain Coordinates for d1imhd1:

Click to download the PDB-style file with coordinates for d1imhd1.
(The format of our PDB-style files is described here.)

Timeline for d1imhd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhd2