SCOP 1.59: Domain d1il0a2: 1il0 A:12-203

Lineage for d1il0a2 (1il0 A:12-203)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (8 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51875] (7 PDB entries)

8. Domain d1il0a2: 1il0 A:12-203 [66190]
   Other proteins in same PDB: d1il0a1, d1il0b1

Details for d1il0a2

PDB Entry: 1il0, 2.2 Å

PDB Description: x-ray crystal structure of the e170q mutant of human l-3-hydroxyacyl- coa dehydrogenase

SCOP Domain Sequences for d1il0a2:

Sequence; same for both SEQRES and ATOM records:

>d1il0a2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqktfeslvdfska
lgkhpvsckdtp

Timeline for d1il0a2:

• d1il0a2 is new in SCOP 1.59
  
• d1il0a2 appears in SCOP 1.61
  
• d1il0a2 appears in the current release, SCOPe 2.08