Lineage for d1ijdf_ (1ijd F:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 202062Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
  4. 202063Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family) (S)
  5. 202064Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein)
  6. 202065Protein Light-harvesting complex subunits [56920] (4 species)
  7. Species Rhodopseudomonas acidophila [69916] (1 PDB entry)
  8. 202082Domain d1ijdf_: 1ijd F: [66160]

Details for d1ijdf_

PDB Entry: 1ijd (more details), 3 Å

PDB Description: crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050

SCOP Domain Sequences for d1ijdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijdf_ f.3.1.1 (F:) Light-harvesting complex subunits {Rhodopseudomonas acidophila}
aevltseqaeelhkhvidgtrvflviaaiahflaftltpw

SCOP Domain Coordinates for d1ijdf_:

Click to download the PDB-style file with coordinates for d1ijdf_.
(The format of our PDB-style files is described here.)

Timeline for d1ijdf_: