Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.3: Transcriptional repressor protein KorB [69242] (1 protein) automatically mapped to Pfam PF06613 |
Protein Transcriptional repressor protein KorB [69243] (1 species) |
Species Escherichia coli [TaxId:562] [69244] (2 PDB entries) |
Domain d1igqc_: 1igq C: [66132] |
PDB Entry: 1igq (more details), 1.7 Å
SCOPe Domain Sequences for d1igqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igqc_ b.34.1.3 (C:) Transcriptional repressor protein KorB {Escherichia coli [TaxId: 562]} dklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg
Timeline for d1igqc_: