SCOPe 2.04: Domain d1igqc_: 1igq C:

Lineage for d1igqc_ (1igq C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.3: Transcriptional repressor protein KorB [69242] (1 protein)
   automatically mapped to Pfam PF06613

6. Protein Transcriptional repressor protein KorB [69243] (1 species)

7. Species Escherichia coli [TaxId:562] [69244] (2 PDB entries)

8. Domain d1igqc_: 1igq C: [66132]

Details for d1igqc_

PDB Entry: 1igq, 1.7 Å

PDB Description: c-terminal domain of transcriptional repressor protein korb

PDB Compounds: (C:) Transcriptional repressor protein KorB

SCOPe Domain Sequences for d1igqc_:

Sequence; same for both SEQRES and ATOM records:

>d1igqc_ b.34.1.3 (C:) Transcriptional repressor protein KorB {Escherichia coli [TaxId: 562]}
dklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg

Timeline for d1igqc_:

• d1igqc_ first appeared in SCOP 1.59
  
• d1igqc_ appears in SCOPe 2.03
  
• d1igqc_ appears in SCOPe 2.05
  
• d1igqc_ appears in the current release, SCOPe 2.08