Lineage for d1i6la_ (1i6l A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468404Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2468405Species Bacillus stearothermophilus [TaxId:1422] [52379] (12 PDB entries)
  8. 2468406Domain d1i6la_: 1i6l A: [66041]
    protein/RNA complex; complexed with gol, nh4, so4, tym

Details for d1i6la_

PDB Entry: 1i6l (more details), 1.72 Å

PDB Description: 1.7 high resolution experimental phases for tryptophanyl-trna synthetase complexed with tryptophanyl-5'amp
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1i6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOPe Domain Coordinates for d1i6la_:

Click to download the PDB-style file with coordinates for d1i6la_.
(The format of our PDB-style files is described here.)

Timeline for d1i6la_: