SCOP 1.65: Domain d1i1ga2: 1i1g A:62-141

Lineage for d1i1ga2 (1i1g A:62-141)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (4 families)
   dimerises through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (1 protein)
   octamer: tetramer of dimers

6. Protein LprA [69734] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [69735] (1 PDB entry)

8. Domain d1i1ga2: 1i1g A:62-141 [65983]
   Other proteins in same PDB: d1i1ga1, d1i1gb1

Details for d1i1ga2

PDB Entry: 1i1g, 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus

SCOP Domain Sequences for d1i1ga2:

Sequence; same for both SEQRES and ATOM records:

>d1i1ga2 d.58.4.2 (A:62-141) LprA {Archaeon Pyrococcus furiosus}
yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
igkiegvtkvcpaiileklk

Timeline for d1i1ga2:

• d1i1ga2 first appeared in SCOP 1.59
  
• d1i1ga2 appears in SCOP 1.63
  
• d1i1ga2 appears in SCOP 1.67
  
• d1i1ga2 appears in the current release, SCOPe 2.08