Lineage for d1ht2j_ (1ht2 J:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263343Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 263344Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 263459Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 263460Protein HslV (ClpQ) protease [56258] (2 species)
    dodecameric prokaryotic homologue of proteasome
  7. 263461Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 263475Domain d1ht2j_: 1ht2 J: [65945]
    Other proteins in same PDB: d1ht2e_, d1ht2f_, d1ht2g_, d1ht2h_

Details for d1ht2j_

PDB Entry: 1ht2 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1ht2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht2j_ d.153.1.4 (J:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1ht2j_:

Click to download the PDB-style file with coordinates for d1ht2j_.
(The format of our PDB-style files is described here.)

Timeline for d1ht2j_: