SCOP 1.71: Domain d1hnnb_: 1hnn B:

Lineage for d1hnnb_ (1hnn B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families)

5. Family c.66.1.15: Phenylethanolamine N-methyltransferase, PNMTase [69547] (1 protein)

6. Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69549] (3 PDB entries)

8. Domain d1hnnb_: 1hnn B: [65896]
   complexed with sah, skf

Details for d1hnnb_

PDB Entry: 1hnn, 2.4 Å

PDB Description: crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)

SCOP Domain Sequences for d1hnnb_:

Sequence; same for both SEQRES and ATOM records:

>d1hnnb_ c.66.1.15 (B:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens)}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv

Timeline for d1hnnb_:

• d1hnnb_ first appeared in SCOP 1.59
  
• d1hnnb_ appears in SCOP 1.69
  
• d1hnnb_ appears in SCOP 1.73
  
• d1hnnb_ appears in the current release, SCOPe 2.08