Lineage for d1hn1b4 (1hn1 B:731-1023)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309200Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1309201Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 1309202Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 1309210Species Escherichia coli [TaxId:562] [49997] (25 PDB entries)
    Uniprot P00722
  8. 1309308Domain d1hn1b4: 1hn1 B:731-1023 [65878]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a5, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b5, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c5, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d5
    complexed with mg, na

Details for d1hn1b4

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1hn1b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1hn1b4:

Click to download the PDB-style file with coordinates for d1hn1b4.
(The format of our PDB-style files is described here.)

Timeline for d1hn1b4: