Lineage for d1hixb_ (1hix B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308405Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1308450Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1308530Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry)
  8. 1308532Domain d1hixb_: 1hix B: [65840]

Details for d1hixb_

PDB Entry: 1hix (more details), 2 Å

PDB Description: crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1hixb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hixb_ b.29.1.11 (B:) Xylanase II {Streptomyces sp. s38, xyl1 [TaxId: 181109]}
vittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvn
ysgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrv
napsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqss
gsssisv

SCOPe Domain Coordinates for d1hixb_:

Click to download the PDB-style file with coordinates for d1hixb_.
(The format of our PDB-style files is described here.)

Timeline for d1hixb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hixa_