Lineage for d1hcjd_ (1hcj D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720241Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 720242Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 720243Family d.22.1.1: Fluorescent proteins [54512] (5 proteins)
  6. 720247Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 720248Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries)
  8. 720272Domain d1hcjd_: 1hcj D: [65795]
    Photoproduct of the wild-type GFP
    complexed with csy; mutant

Details for d1hcjd_

PDB Entry: 1hcj (more details), 1.8 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein
PDB Compounds: (D:) Green fluorescent protein

SCOP Domain Sequences for d1hcjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcjd_ d.22.1.1 (D:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOP Domain Coordinates for d1hcjd_:

Click to download the PDB-style file with coordinates for d1hcjd_.
(The format of our PDB-style files is described here.)

Timeline for d1hcjd_: