Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (2 families) |
Family d.22.1.1: Fluorescent proteins [54512] (5 proteins) |
Protein Green fluorescent protein, GFP [54513] (1 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries) |
Domain d1hcja_: 1hcj A: [65792] |
PDB Entry: 1hcj (more details), 1.8 Å
SCOP Domain Sequences for d1hcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcja_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
Timeline for d1hcja_: