Lineage for d1goza2 (1goz A:1122-1238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934389Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2934390Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2934396Domain d1goza2: 1goz A:1122-1238 [65436]
    Other proteins in same PDB: d1goza1, d1gozb1
    mutant

Details for d1goza2

PDB Entry: 1goz (more details), 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d1goza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goza2 d.15.6.1 (A:1122-1238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOPe Domain Coordinates for d1goza2:

Click to download the PDB-style file with coordinates for d1goza2.
(The format of our PDB-style files is described here.)

Timeline for d1goza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1goza1