Lineage for d1g1rc1 (1g1r C:1-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607578Protein P-selectin, C-lectin domain [116731] (1 species)
    followed by EGF-like module
  7. 2607579Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries)
  8. 2607588Domain d1g1rc1: 1g1r C:1-118 [65096]
    Other proteins in same PDB: d1g1ra2, d1g1ra3, d1g1rb2, d1g1rb3, d1g1rc2, d1g1rc3, d1g1rd2, d1g1rd3
    complexed with ca, mrd

Details for d1g1rc1

PDB Entry: 1g1r (more details), 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex
PDB Compounds: (C:) p-selectin

SCOPe Domain Sequences for d1g1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1rc1 d.169.1.1 (C:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOPe Domain Coordinates for d1g1rc1:

Click to download the PDB-style file with coordinates for d1g1rc1.
(The format of our PDB-style files is described here.)

Timeline for d1g1rc1: