Lineage for d1fxzc1 (1fxz C:10-248)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330471Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 1330495Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 1330567Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)
  8. 1330572Domain d1fxzc1: 1fxz C:10-248 [65063]

Details for d1fxzc1

PDB Entry: 1fxz (more details), 2.8 Å

PDB Description: crystal structure of soybean proglycinin a1ab1b homotrimer
PDB Compounds: (C:) glycinin g1

SCOPe Domain Sequences for d1fxzc1:

Sequence, based on SEQRES records: (download)

>d1fxzc1 b.82.1.2 (C:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfregdliavptgv
awwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeqgghqsqkgk
hqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvkgglsvikp

Sequence, based on observed residues (ATOM records): (download)

>d1fxzc1 b.82.1.2 (C:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
ekgaivtvkgglsvikp

SCOPe Domain Coordinates for d1fxzc1:

Click to download the PDB-style file with coordinates for d1fxzc1.
(The format of our PDB-style files is described here.)

Timeline for d1fxzc1: