SCOP 1.73: Domain d2a8vc1: 2a8v C:1-47

Lineage for d2a8vc1 (2a8v C:1-47)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family)

5. Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)

6. Protein Rho termination factor, N-terminal domain [68914] (1 species)

7. Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)

8. Domain d2a8vc1: 2a8v C:1-47 [64756]
   Other proteins in same PDB: d2a8va2, d2a8vb2, d2a8vc2
   protein/RNA complex

Details for d2a8vc1

PDB Entry: 2a8v, 2.4 Å

PDB Description: rho transcription termination factor/rna complex

PDB Compounds: (C:) RNA binding domain of rho transcription termination factor

SCOP Domain Sequences for d2a8vc1:

Sequence; same for both SEQRES and ATOM records:

>d2a8vc1 a.140.3.1 (C:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

Timeline for d2a8vc1:

• d2a8vc1 first appeared in SCOP 1.59
  
• d2a8vc1 appears in SCOP 1.71
  
• d2a8vc1 appears in SCOP 1.75
  
• d2a8vc1 appears in the current release, SCOPe 2.08