Lineage for d1en7b1 (1en7 B:104-157)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218432Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 218466Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) (S)
  5. 218467Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)
  6. 218468Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)
  7. 218469Species Bacteriophage T4 [TaxId:10665] [54074] (3 PDB entries)
  8. 218473Domain d1en7b1: 1en7 B:104-157 [64735]
    Other proteins in same PDB: d1en7a2, d1en7b2

Details for d1en7b1

PDB Entry: 1en7 (more details), 2.4 Å

PDB Description: endonuclease vii (endovii) from phage t4

SCOP Domain Sequences for d1en7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en7b1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOP Domain Coordinates for d1en7b1:

Click to download the PDB-style file with coordinates for d1en7b1.
(The format of our PDB-style files is described here.)

Timeline for d1en7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1en7b2