Lineage for d1a62a1 (1a62 A:1-47)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649863Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 649902Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 649903Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 649904Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 649905Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
  8. 649906Domain d1a62a1: 1a62 A:1-47 [64708]
    Other proteins in same PDB: d1a62a2

Details for d1a62a1

PDB Entry: 1a62 (more details), 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho
PDB Compounds: (A:) rho

SCOP Domain Sequences for d1a62a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a62a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1a62a1:

Click to download the PDB-style file with coordinates for d1a62a1.
(The format of our PDB-style files is described here.)

Timeline for d1a62a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a62a2