Lineage for d1joka_ (1jok A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries) 
Domain d1joka_: 1jok A: [63214]
Details for d1joka_
PDB Entry: 1jok (more details)
PDB Description: averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
SCOP Domain Sequences for d1joka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joka_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqllrkseaqakkeklniwsednadsgq
SCOP Domain Coordinates for d1joka_:
Click to download the PDB-style file with coordinates for d1joka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1joka_:
- d1joka_ first appeared in SCOP 1.57
- d1joka_ appears in SCOP 1.61
- d1joka_ appears in the current release, SCOPe 2.08
View in 3D