SCOPe 2.08: Domain d1jl8a2: 1jl8 A:503-585

Lineage for d1jl8a2 (1jl8 A:503-585)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1jl8a2: 1jl8 A:503-585 [63164]
   Other proteins in same PDB: d1jl8a1, d1jl8a3, d1jl8b1, d1jl8b3

Details for d1jl8a2

PDB Entry: 1jl8, 3.2 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with beta-cyclodextrin based on a co-crystallization with methyl beta-cyclodextrin

PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1jl8a2:

Sequence; same for both SEQRES and ATOM records:

>d1jl8a2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1jl8a2:

• d1jl8a2 first appeared in SCOP 1.57
  
• d1jl8a2 appears in SCOPe 2.07