Lineage for d1jk8b2 (1jk8 B:3-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938375Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [88825] (1 PDB entry)
  8. 2938376Domain d1jk8b2: 1jk8 B:3-94 [63148]
    Other proteins in same PDB: d1jk8a1, d1jk8a2, d1jk8b1
    complexed with a human insulin peptide
    complexed with nag

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1jk8b2

PDB Entry: 1jk8 (more details), 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex
PDB Compounds: (B:) MHC class II HLA-DQ8

SCOPe Domain Sequences for d1jk8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk8b2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ8 [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrr

SCOPe Domain Coordinates for d1jk8b2:

Click to download the PDB-style file with coordinates for d1jk8b2.
(The format of our PDB-style files is described here.)

Timeline for d1jk8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jk8b1